 Friends links |
|
| Picture |
Heading |
Updated |
 |
Catfish Food
Model Number: Catfish Food
Brand Name: YATAI
Key Specifications/Special Features:
Fish foodProtein: 30% minMoisture: 8% maxAsh: 12% maxCrude fiber: 12% maxAppearance: brown yellowPacking: 25kg/bag, PP bags with PE linersLoading quantity:1*20''... |
2017-12-30 |
 |
High Quality Floating Fish Feed Pellet for Catfish
Model Number: animal feed
Brand Name: yatai
Key Specifications/Special Features:
Directions for Use1.Accordingtogrowthcycledeterminefeedingfeedtype,inordertomeetthecatfishdifferentgrowthstagesofnutritionalrequirements.2.Do"timing,point,quantitat... |
2017-12-09 |
 |
Soybean meal for animal feed, protein 42-46 pct
Model Number: YT118
Brand Name: yatai
Key Specifications/Special Features:
High quality soybean mealProducts information:Crude protein: 42%minMoisture: ≤10%Crude fat: ≤10%Certificate: PONY SGSStorage: stored in a cool, ventilated and dry placePa... |
2017-12-04 |
|
